PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010535799.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family ARF
Protein Properties Length: 1113aa    MW: 122590 Da    PI: 6.5831
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010535799.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.32.2e-21127227198
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      +++++  ++l+ +d +  +W +++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   ++++
  XP_010535799.1 127 FCKTLTASDTSTHGGFSVPRRAAEKIfppldySMQPPA-QELVAKDIHDTTWAFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI--RDMK 218
                     99*****************************9545444.38************************************************..5677 PP

                     E..EEEEE- CS
              B3  90 felvvkvfr 98 
                      +l+++++ 
  XP_010535799.1 219 SQLLLGIRH 227
                     778998876 PP

2Auxin_resp122.53.1e-40253335183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     aahaa+++s+F+++YnPra+++eFvv+++k+ ka++ +vs+GmRf+m+feted+  rr++Gtv+g+sdldpvrW+nS+Wr+L+
  XP_010535799.1 253 AAHAAANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMMFETEDCGVRRYMGTVTGISDLDPVRWKNSQWRNLQ 335
                     79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.19E-44117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.0E-40120242IPR015300DNA-binding pseudobarrel domain
CDDcd100178.79E-18126226No hitNo description
PfamPF023625.0E-19127227IPR003340B3 DNA binding domain
PROSITE profilePS5086311.589127229IPR003340B3 DNA binding domain
SMARTSM010196.2E-20127229IPR003340B3 DNA binding domain
PfamPF065075.1E-35253335IPR010525Auxin response factor
PfamPF023091.0E-99831072IPR033389AUX/IAA domain
PROSITE profilePS5174526.9569861079IPR000270PB1 domain
SuperFamilySSF542779.81E-99991064No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1113 aa     Download sequence    Send to blast
MKSPSSNGVS PNPGGGEKKT INSELWHACA GPLISLPPAG SLVVYFPQGH SEQVAASMQK  60
QTDFIPSYPN LPSKLICMLH CVTLHADRET DEVYAQMTLQ PVNKYEKEAL LASDMGLKQN  120
NQPAEFFCKT LTASDTSTHG GFSVPRRAAE KIFPPLDYSM QPPAQELVAK DIHDTTWAFR  180
HIYRGQPKRH LLTTGWSVFV STKRLFAGDS VLFIRDMKSQ LLLGIRHANR QQPALSSSVI  240
SSDSMHIGIL AAAAHAAANN SPFTIFYNPR AAPAEFVVPL AKYTKAMYAQ VSLGMRFRMM  300
FETEDCGVRR YMGTVTGISD LDPVRWKNSQ WRNLQVGWDE SAAGDRPSRV SVWDIEPVLT  360
PFYICPPPFF RPMFTGQPGM PDDENDIENA LKRAMPWLGD SFGMKDSSSS IFPGLSLVQW  420
MNMQQNGQLP VAQSGFFPSM VSPSAVHNNL GSEDSSKLLN FQAPAGLSSP NLQFNKPNPQ  480
AQLPQLPQPP TTLSQQQQLQ PLLQTSLXXX XXXXXTQQQQ QQQQQLQLQQ QQQQQQLKLQ  540
SQQQQLQPQQ QMQPPQPSLQ PHKLQQLAQQ QQLYNGSSQA QQLQMASASI TSNTITPSLI  600
VSQSFQQSQH QQTQMPLVTS NSQQPSQGSV NETGKTSSNL TTIPQDSQFQ PRQVEQQISG  660
MLQQSLPQKA HQAQVQQIFQ QGLLDNQPHL QFQLLQKLQQ QQQQQQQQQQ QQLLSPGSSL  720
LQSQLLHQQL QNQQLQQLPS CSNSLSTSTL PQSMQIPASQ SQDKQKLLEG IKPYPGIMDG  780
DPPSCSTSPS TNNCQVSSSN LLNRSQSGPA GLAPDAVSDV SGNLVHEFYN KPDMRLKQDL  840
ASSRGSDPQK FKVGVTDQLE AASASGTSYC LDGGNKQRNF SAPAFCLDGD AAQSHPRNGL  900
LPGANVESFV PDTFLSRGYD SQKDLQNLLS SYGGTTNDIG TEMSTSAART QSFGVPNVPA  960
ISNDVAVNDA GVLGGGLWAN QTQRMRTYTK VQKRGSVGRS IDVNRYRGYD ELRHDLARMF  1020
GIEGQLEDPQ TSDWKLVYVD HENDILLVGD DPWEEFVNCV QSIKILSSAE VQQMSLDGNF  1080
AGLSVPNEAC SGGDSGNGWR GHYGDNSAAS FNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1701535645388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010535799.10.0PREDICTED: auxin response factor 7-like
TrEMBLA0A078DU450.0A0A078DU45_BRANA; Auxin response factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein